PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_36942.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 402aa    MW: 42831.8 Da    PI: 5.2728
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_36942.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM157.55.4e-4961331128
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                   lppG+rFhPtd el  +yLk+k+ gkkl++ ++++evdiyk+ Pw+Lp k ++ +++ +wyfF++r +ky+ g r+nr+t+ gyWkatgkd++v+  
  MLOC_36942.1   6 LPPGYRFHPTDVELTLYYLKRKLLGKKLHC-NTVAEVDIYKFPPWELPaKsSMPTGDLQWYFFCTRGRKYSVGYRTNRSTEGGYWKATGKDRQVVY- 100
                   79****************************.88***************4246666888**************************************. PP

           NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                   ++++vg+k+tLvf+ g+apkg++tdWvm eyrl
  MLOC_36942.1 101 ENRTVGMKRTLVFHAGKAPKGTRTDWVMYEYRL 133
                   9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.02E-582156IPR003441NAC domain
PROSITE profilePS5100554.5796156IPR003441NAC domain
PfamPF023655.4E-257133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MDMPPLPPGY RFHPTDVELT LYYLKRKLLG KKLHCNTVAE VDIYKFPPWE LPAKSSMPTG  60
DLQWYFFCTR GRKYSVGYRT NRSTEGGYWK ATGKDRQVVY ENRTVGMKRT LVFHAGKAPK  120
GTRTDWVMYE YRLAQGEIPD AGARLDDSVL CKVHKKSGLG PKIGEQYGVP FEEVEEELND  180
AKGDASCLSP SAPPAAPQSA SGPSRGDVLN SAGEQLVSLS LSPSNNGESA ASGARPDRAS  240
CPDVNWDSIH VHQLADIIGH ISTNPVGQDG PSSDLTTANQ DTEALSDNSE SIFDIAHQVV  300
PSSLGSSLCK QCDKCGVRLV DPLLEPVAGE PYVELNDLLS RCGAAGHVRD GSSSQAVVLS  360
NGEGPPLDLE LKLGLGLESC DSVGHSSGAV SAAASGSGAP SS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-49615717166NO APICAL MERISTEM PROTEIN
1ut4_B9e-49615717166NO APICAL MERISTEM PROTEIN
1ut7_A9e-49615717166NO APICAL MERISTEM PROTEIN
1ut7_B9e-49615717166NO APICAL MERISTEM PROTEIN
3swm_A1e-48615720169NAC domain-containing protein 19
3swm_B1e-48615720169NAC domain-containing protein 19
3swm_C1e-48615720169NAC domain-containing protein 19
3swm_D1e-48615720169NAC domain-containing protein 19
3swp_A1e-48615720169NAC domain-containing protein 19
3swp_B1e-48615720169NAC domain-containing protein 19
3swp_C1e-48615720169NAC domain-containing protein 19
3swp_D1e-48615720169NAC domain-containing protein 19
4dul_A9e-49615717166NAC domain-containing protein 19
4dul_B9e-49615717166NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00583DAPTransfer from AT5G64060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3707770.0AK370777.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2116L22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003581627.11e-127PREDICTED: NAC domain-containing protein 102-like
TrEMBLM0VST00.0M0VST0_HORVD; Uncharacterized protein
STRINGMLOC_36942.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP148561721
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64060.11e-56NAC domain containing protein 103